Skip to main content

SFMBT2 Antibody

Catalog # NBP1-93582 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-93582
NBP1-93582-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for SFMBT2 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DFWCDVVIADLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQN

Predicted Species

Mouse (91%). Backed by our 100% Guarantee.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SFMBT2 Antibody

Immunohistochemistry-Paraffin: SFMBT2 Antibody [NBP1-93582] - Staining of human appendix shows cytoplasmic positivity in lymphoid tissue.

Applications for SFMBT2 Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFMBT2

Alternate Names

KIAA1617, Scm-like with four mbt domains 2, scm-like with four MBT domains protein 2

Gene Symbol

SFMBT2

Product Documents for SFMBT2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SFMBT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...