Skip to main content

Serpin A1/alpha 1-Antitrypsin Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-90309

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90309
NBP1-90309-25ul

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Serpin A1/alpha 1-Antitrypsin Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Serpin A1/alpha 1-Antitrypsin Antibody

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis in human kidney and cerebral cortex tissues using NBP1-90309 antibody. Corresponding SERPINA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex, kidney, placenta and testis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar protein distribution across tissues to independent antibody NBP1-90308 (B).
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar pattern to independent antibody NBP1-90308 (B).

Applications for Serpin A1/alpha 1-Antitrypsin Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500-1:5000

Simple Western

Reported by internal validation

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western internal validation: Human fibroblast lysates from Alpha-1-antitrypsin deficiency (AATD) and normal patients as samples; separated by size; antibody dilution of 1:125; detected by Chemiluminescence.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 8 publications using NBP1-90309 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Serpin A1/alpha 1-Antitrypsin

Alpha 1 Antitrypsin, also known as SERPINA1, is a plasma protein synthesised in the liver. It consists of a single polypeptide chain and has a molecular weight of 52 kDa. A serine protease inhibitor, its primary function is the protection of lung tissue from the action of neutrophil elastase. The average level of alpha 1 Antitrypsin in plasma is 1.3 g/l.

Alternate Names

A1AT, alpha 1-Antitrypsin, alpha 1-Proteinase Inhibitor

Gene Symbol

SERPINA1

Additional Serpin A1/alpha 1-Antitrypsin Products

Product Documents for Serpin A1/alpha 1-Antitrypsin Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Serpin A1/alpha 1-Antitrypsin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...