Skip to main content

Semenogelin II Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92376

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-92376
NBP1-92376-25ul

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EERHLNCGEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Semenogelin II Antibody - BSA Free (NBP1-92376) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Semenogelin II Antibody - BSA Free

Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376]

Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376]

Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human kidney.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376]

Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376]

Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human seminal vesicle shows high expression.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376]

Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376]

Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human skeletal muscle shows low expression as expected.

Applications for Semenogelin II Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Semenogelin II

Semenogelin I (SgI) and Semenogelin II (SgII) are the major seminal vesicle secreted proteins in human semen (reviewed in Lundwall, 2002 and Bonilha et al, 2006). SgI and SgII, in semen both originate from the glandular epithelium of the seminal vesicles which secrete them at high concentrations. SgII is also secreted by the epididymis at lower concentrations. SgI and SgII interact both non-covalently and covalently by disulphide bridges to instantly form a gel-like coagulum upon ejaculation. Fibronectin is also a key component of the coagulum. The gel structure dissolves spontaneously within minutes after ejaculation as a result of proteolytic degradation of SgI/SgII by prostatic serine protease (PSA) and other proteases which cleave SgI/SgII into fragments. The high concentration of SgI/SgII in human semen led to the concept of SgI/SgII as a potentially useful marker for semen identification (reviewed in Pang and Cheung, 2006). Whereas SgI/SgII were originally identified as the major components present in seminal vesicle secretion, they are now known to be expressed in a number of tissues. The list includes seminal vesicles, epididymis, vas deferens, prostate, skeletal muscle, kidney, colon, trachea, lung, breast and retina as well as in several malignant tissues and cell lines (reviewed in Lundwall, 2002 and Bonilha et al, 2006). The non-genital expression of SgI/SgII suggests that these proteins also have functions that are unrelated to sperm. Human Sg1 is a non-glycosylated protein of 439 amino acids with a molecular weight of ~50 kDa. A few percent of the worlds population also carry an allele that gives rise to a truncated SgI molecule with a molecular mass of 43 kDa. Human SgII is a 559 amino acid protein with a molecular weight of approx. 63 kDa. SgII has a potential site for N-linked glycosylation and approximately half of the molecules in human semen are glycosylated yielding two SgII species with a different of 5 kDa. SgI has a single Cys residue and SgII has two Cys residues, and the molecules can exist as covalent homo- and heteromultimers.

Alternate Names

semenogelin IISGIISemenogelin 2, semenogelin-2

Gene Symbol

SEMG2

Additional Semenogelin II Products

Product Documents for Semenogelin II Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Semenogelin II Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...