Skip to main content

S5a/Angiocidin Antibody (5G1X6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16240

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16240-100ul
NBP3-16240-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5G1X6 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-350 of human S5a/Angiocidin (P55036). TTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S5a/Angiocidin Antibody (5G1X6)

Western Blot: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240]

Western Blot: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240]

Western Blot: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240] - Western blot analysis of extracts of various cell lines, using S5a/Angiocidin Rabbit mAb (NBP3-16240) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240]

Immunocytochemistry/ Immunofluorescence: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240]

Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240] - Immunofluorescence analysis of NIH-3T3 cells using S5a/Angiocidin Rabbit mAb (NBP3-16240) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
S5a/Angiocidin Antibody (5G1X6)

Immunocytochemistry/ Immunofluorescence: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240] -

Immunocytochemistry/ Immunofluorescence: S5a/Angiocidin Antibody (5G1X6) [NBP3-16240] - Immunofluorescence analysis of NIH-3T3 cells using S5a/Angiocidin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for S5a/Angiocidin Antibody (5G1X6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: S5a/Angiocidin

S5a/Angiocidin, also known as Anti-secretory Factor (ASF), is classified under the gene PSMD4, but is often referred to by a different name depending on the context in which it is described. S5a and ASF have identical 377 amino acid (aa) sequences, while Angiocidin is described as having an additional Gly255Glu256Arg257 sequence in its C-Terminus. The human protein shares 96% and 99% aa sequence identity with its mouse and rat orthologs, respectively. Structurally, it contains an N-terminal von Willebrand Factor type A domain and two C-terminal Ubiquitin-interacting motifs (UIM). It acts as a Ubiquitin-binding protein where it is most commonly referred to as S5a or in yeast as Rpn10. It is part of the 19S regulatory subunit of the 26S Proteasome where its UIM recognizes poly-ubiquitinated proteins destined for degradation. As a part of the proteasome complex, it may also recognize the Ubiquitin-like modifier FAT10. Free cytoplasmic forms also exist where its ubiquitination is catalyzed by a range of Ubiquitin E3 ligases from different classes. Therefore, experimentally S5a/Angiocidin may act as a useful substrate to monitor the activity of (E3) ligases, independent of their specific mechanisms of action. In cancer biology, where it is often referred to as Angiocidin, it is shown to slow tumor progression. It is found in the extracellular matrix of certain tumor subtypes, and it may act by suppressing angiogenesis or by directly inhibiting tumor cell growth. It also is found in several biological fluids where it is known primarily as ASF. It suppresses fluid secretion in response to enterotoxin and may act as an anti-inflammatory factor.

Long Name

26S Proteasome Regulatory Subunit S5a

Alternate Names

Angiocidin, ASF, Macropain, Mcb1, PSMD4, pUB-R5, Rpn10, S5a

Gene Symbol

PSMD4

Additional S5a/Angiocidin Products

Product Documents for S5a/Angiocidin Antibody (5G1X6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for S5a/Angiocidin Antibody (5G1X6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...