RFX5 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25102

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-25102
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all RFX5 Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein RFX5 using the following amino acid sequence: TVSKGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit RFX5 Antibody - BSA Free (NBP3-25102) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RFX5 Antibody - BSA Free

RFX5 Antibody Immunocytochemistry/Immunofluorescence: RFX5 Antibody [NBP3-25102]

Immunocytochemistry/Immunofluorescence: RFX5 Antibody [NBP3-25102]

Staining of human cell line JURKAT shows localization to nucleoplasm.
RFX5 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: RFX5 Antibody - BSA Free [NBP3-25102]

Chromatin Immunoprecipitation-exo-Seq: RFX5 Antibody - BSA Free [NBP3-25102]

ChIP-Exo-Seq composite graph for Anti-RFX5 (NBP3-25102) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for RFX5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFX5

RFX5 is the regulatory gene responsible for human MHC class II deficiency. Patients with this disease exhibit a characteristic defect in the binding of a nuclear factor, RFX, to the X box motif of MHC class II promoters. RFX5 is the 75 kDa subunit of the RFX complex which is absolutely essential and highly specific for regulating MHC class II gene expression and control of the immune response. RFX5 is a protein consisting of 616 amino acids.

Alternate Names

DNA-binding protein RFX5, Regulatory factor X 5, regulatory factor X, 5 (influences HLA class II expression)

Gene Symbol

RFX5

Additional RFX5 Products

Product Documents for RFX5 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RFX5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved.