Skip to main content

RFX5 Antibody (3B8), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00005993-M02

Catalog #
Availability
Size / Price
Qty
Loading...
H00005993-M02

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3B8

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for RFX5 Antibody (3B8)

Immunogen

RFX5 (NP_000440, 516 a.a. ~ 616 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP

Specificity

RFX5 - regulatory factor X, 5 (influences HLA class II expression)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for RFX5 Antibody (3B8)

Sandwich ELISA: RFX5 Antibody (3B8) [H00005993-M02] - Detection limit for recombinant GST tagged RFX5 is 0.1 ng/ml as a capture antibody.

Applications for RFX5 Antibody (3B8)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RFX5

A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined.

Alternate Names

DNA-binding protein RFX5, Regulatory factor X 5, regulatory factor X, 5 (influences HLA class II expression)

Entrez Gene IDs

5993 (Human)

Gene Symbol

RFX5

OMIM

209920 (Human)

Additional RFX5 Products

Product Documents for RFX5 Antibody (3B8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RFX5 Antibody (3B8)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...