Skip to main content

Rev-erb beta/NR1D2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00009975-D01P

Catalog #
Availability
Size / Price
Qty
Loading...
H00009975-D01P

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Rev-erb beta/NR1D2 Antibody

Immunogen

NR1D2 (NP_005117.2, 1 a.a. - 579 a.a.) full-length human protein. MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP

Specificity

NR1D2 - nuclear receptor subfamily 1, group D, member 2,

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rev-erb beta/NR1D2 Antibody

Western Blot: Rev-erb beta/NR1D2 Antibody [H00009975-D01P] - Analysis of NR1D2 expression in mouse liver.
Western Blot: Rev-erb beta/NR1D2 Antibody [H00009975-D01P] - Analysis of NR1D2 expression in HeLa.
Western Blot: Rev-erb beta/NR1D2 Antibody [H00009975-D01P] - Analysis of NR1D2 expression in transfected 293T cell line by NR1D2 polyclonal antibody.Lane 1: NR1D2 transfected lysate(64.70 KDa).Lane 2: Non-transfected lysate.

Applications for Rev-erb beta/NR1D2 Antibody

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Rev-erb beta/NR1D2

The NR1D2 gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Al

Alternate Names

BD73, EAR-1R, NR1D2, Reverb beta

Entrez Gene IDs

9975 (Human)

Gene Symbol

NR1D2

Additional Rev-erb beta/NR1D2 Products

Product Documents for Rev-erb beta/NR1D2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Rev-erb beta/NR1D2 Antibody

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...