Skip to main content

RABGAP1L Antibody (2D3)

Catalog # H00009910-M05 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
H00009910-M05

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2D3

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for RABGAP1L Antibody (2D3)

Immunogen

RABGAP1L (NP_055672.3, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLEKAMEEILRDSEKRPSSLLVDCQSSSEISDHSFGDIPASQTNKPSLQLILDPSNT

Specificity

Reacts with RAB GTPase activating protein 1-like.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for RABGAP1L Antibody (2D3)

Western Blot: RABGAP1L Antibody (2D3) [H00009910-M05] - Analysis of RABGAP1L expression in HepG2 (Cat # L019V1).
Immunohistochemistry-Paraffin: RABGAP1L Antibody (2D3) [H00009910-M05] - Analysis of monoclonal antibody to RABGAP1L on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
ELISA: RABGAP1L Antibody (2D3) [H00009910-M05] - Detection limit for recombinant GST tagged RABGAP1L is 0.03 ng/ml as a capture antibody.

Applications for RABGAP1L Antibody (2D3)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RABGAP1L

Alternate Names

DKFZp686E1450, FLJ58037, FLJ79118, heart, liver (HLL), HHLFLJ79254, RAB GTPase activating protein 1-like, rab GTPase-activating protein 1-like, TBC1 domain family, member 18, TBC1D18

Entrez Gene IDs

9910 (Human)

Gene Symbol

RABGAP1L

Product Documents for RABGAP1L Antibody (2D3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RABGAP1L Antibody (2D3)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...