Skip to main content

Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15470

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15470-100ul
NBP3-15470-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8Z4N6 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Pyruvate Dehydrogenase E1-alpha subunit (P08559). PPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) (NBP3-15470) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6)

Western Blot: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [NBP3-15470]

Western Blot: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [NBP3-15470]

Western Blot: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [NBP3-15470] - Western blot analysis of extracts of various cell lines, using Pyruvate Dehydrogenase E1-alpha subunit Rabbit mAb (NBP3-15470) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [NBP3-15470]

Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [NBP3-15470]

Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [NBP3-15470] - Immunofluorescence analysis of NIH-3T3 cells using Pyruvate Dehydrogenase E1-alpha subunit Rabbit mAb (NBP3-15470) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6)

Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [Pyruvate Dehydrogenase E1-alpha subunit] -

Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6) [Pyruvate Dehydrogenase E1-alpha subunit] - Confocal imaging of C2C12 cells using Pyruvate Dehydrogenase E1-alpha subunit Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pyruvate Dehydrogenase E1-alpha subunit

Pyruvate Dehydrogenase E1-alpha subunit (PDHE1 alpha) is a member of the pyruvate dehydrogenase complex (PDC) and is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1 or PDHE1), dihydrolipoyl transacetylase (DLAT), and dihydrolipoyl dehydrogenase (DLD). The E1 enzyme is a heterotetramer of 2 alpha and 2 beta subunits. The E1-alpha subunit contains the E1 active site and plays a key role in the function of the PDH complex. Enhanced expression of pyruvate dehydrogenase kinase-1 (PDK-1) results in phosphorylation of PDHE1 alpha at Serine 293, which in turn produces nearly complete inhibition of the pyruvate dehydrogenase complex (PDC). A recent study shows that inhibition of PDC activity in cancer cells restores normoxic stablization of HIF-1 alpha by glycolytic metabolites.

Alternate Names

EC 1.2.4.1, PDHA, PDHE1-A type I, PHE1APDHCE1A, pyruvate dehydrogenase (lipoamide) alpha 1, pyruvate dehydrogenase complex, E1-alpha polypeptide 1, pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial

Gene Symbol

PDHA1

Additional Pyruvate Dehydrogenase E1-alpha subunit Products

Product Documents for Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Pyruvate Dehydrogenase E1-alpha subunit Antibody (8Z4N6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...