Skip to main content

PTP epsilon Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38398

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-38398-20ul
NBP3-38398-100ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human PTP epsilon (NP_006495.1).

Sequence:
LRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit PTP epsilon Antibody - BSA Free (NBP3-38398) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PTP epsilon Antibody - BSA Free

PTP epsilon Antibody

Immunohistochemistry: PTP epsilon Antibody [NBP3-38398] -

Immunohistochemistry: PTP epsilon Antibody [NBP3-38398] - Immunohistochemistry analysis of paraffin-embedded Rat brain using PTP epsilon Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
PTP epsilon Antibody

Western Blot: PTP epsilon Antibody [NBP3-38398] -

Western Blot: PTP epsilon Antibody [NBP3-38398] - Western blot analysis of various lysates using PTP epsilon Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
PTP epsilon Antibody

Immunohistochemistry: PTP epsilon Antibody [NBP3-38398] -

Immunohistochemistry: PTP epsilon Antibody [NBP3-38398] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using PTP epsilon Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for PTP epsilon Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PTP epsilon

PTP epsilon, an R4 receptor protein tyrosine phosphatase, is composed of a short extracellular and two cyplasmic protein phosphatase domains and has been shown to affect neuronal differentiation, endothelial cell growth, vascular development, and possibly mammary tumor development. It has been shown that the cytosolic form of PTP epsilon can be induced by IL-1 and TNF alpha in humans and is a negative regulator of IL-6- and LIF-induced Jak-STAT kinase signaling in rats. Four alternatively spliced protein isoforms have been documented for PTP epsilon: a membrane form, a cytosolic form, the p65 form, which results from translation using an internal initiation codon, and the p67 form, which results from a specific proteolytic cleavage of wild-type PTP epsilon. PTP epsilon expression has been documented in human vascular endothelial cells, astrocytoma cells, and in IW32 erythroleukemia overexpressing p53. PTP epsilon expression has been documented in animal brain, breast, ganglion, heart, kidney, liver, lung, nerve, spinal cord, spleen, testis, and vessel. The membrane and cytosolic forms of PTP epsilon show different tissue expression patterns. ESTs have been isolated from numerous human tissue libraries, including normal human blood, brain, testis, and thyroid, and cancerous human blood, brain, breast, colon, embryo, head/neck, pancreas, and skin.

Alternate Names

DKFZp313F1310, EC 3.1.3.48, FLJ57799, FLJ58245, HPTPE, protein tyrosine phosphatase epsilon, protein tyrosine phosphatase, receptor type, E, protein tyrosine phosphatase, receptor type, epsilon polypeptide, Protein-tyrosine phosphatase epsilon, PTPE, receptor-type tyrosine-protein phosphatase epsilon, R-PTP-epsilon

Gene Symbol

PTPRE

Additional PTP epsilon Products

Product Documents for PTP epsilon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PTP epsilon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...