Skip to main content

PTGER2 Antibody (2G10L6), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP3-16740

Recombinant Monoclonal Antibody
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16740-20ul
NBP3-16740-100ul

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2G10L6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for PTGER2 Antibody (2G10L6)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 259-358 of human PTGER2 (P43116). ETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTGER2 Antibody (2G10L6)

Western Blot: PTGER2 Antibody (2G10L6) [NBP3-16740] - Analysis of extracts of various cell lines, using PGE Receptor EP2 (PGE Receptor EP2 (PTGER2)) Rabbit mAb (NBP3-16740) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/Immunofluorescence: PTGER2 Antibody (2G10L6) [NBP3-16740] - Immunofluorescence analysis of U-2 OS cells using PGE Receptor EP2 (PGE Receptor EP2 (PTGER2)) Rabbit mAb (NBP3-16740) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PTGER2 Antibody (2G10L6) [NBP3-16740] - Human placenta using PGE Receptor EP2 (PGE Receptor EP2 (PTGER2)) Rabbit mAb (NBP3-16740) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for PTGER2 Antibody (2G10L6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PTGER2

Prostaglandin E2, a member of the autacoid family of lipid mediators, is a major renal cyclooxygenase product of arachidonic acid metabolism.Prostaglandin E2 binds to four G protein-coupled E-prostanoid receptors,designated EP1, EP2, EP3 and EP4. The expression and function of the prostaglandin E2 receptors have been highly characterized in kidney. EP1,which is predominantly expressed in the collecting duct, couples to Gq proteins to inhibit sodium absorption and increase in intracellular calcium, which act as second messengers. EP2 is coupled to Gs proteins, which stimulate adenylyl cyclase. EP2 has the lowest expression in kidney, but EP2 knockout mice exhibit salt-sensitive hypertension, which suggests a role for EP2 in salt excretion. EP3 is expressed in renal vessels, thick ascending limb and collecting duct. EP3 has at least 6 alternative splice variants that couple to Gi proteins to inhibit cAMP, which subsequently inhibit sodium and water transport. In uterus, EP3 induces the contraction of uterine smooth muscles.EP4 is expressed in glomerulus and collecting duct. It couples to Gs proteins,which stimulate adenylyl cyclase and regulate glomerular tone and renal renin release.

Long Name

Prostaglandin E2 Receptor 2, Subtype EP2

Alternate Names

EP2

Gene Symbol

PTGER2

Additional PTGER2 Products

Product Documents for PTGER2 Antibody (2G10L6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PTGER2 Antibody (2G10L6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...