Skip to main content

PTCD3 Antibody

Catalog # NBP1-84125 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84125
NBP1-84125-25ul

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for PTCD3 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTCD3 Antibody

Western Blot: PTCD3 Antibody [NBP1-84125] - Analysis using Anti-PTCD3 antibody NBP1-84125 (A) shows similar pattern to independent antibody NBP1-84126 (B).
Immunocytochemistry/Immunofluorescence: PTCD3 Antibody [NBP1-84125] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PTCD3 Antibody [NBP1-84125] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.

Applications for PTCD3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTCD3

Alternate Names

DKFZp666K071, FLJ20758, Pentatricopeptide repeat domain 3, pentatricopeptide repeat-containing protein 3, mitochondrial, Transformation-related gene 15 protein, TRG-15

Gene Symbol

PTCD3

Product Documents for PTCD3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PTCD3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...