Skip to main content

PPP1R7 Antibody

Catalog # NBP2-38207 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38207
NBP2-38207-25ul

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for PPP1R7 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATF

Predicted Species

Mouse (99%), Rat (100%). Backed by our 100% Guarantee.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPP1R7 Antibody

Immunocytochemistry/Immunofluorescence: PPP1R7 Antibody [NBP2-38207] - Staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry: PPP1R7 Antibody [NBP2-38207] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
PPP1R7 Antibody

Western Blot: PPP1R7 Antibody [NBP2-38207] -

Western Blot: PPP1R7 Antibody [NBP2-38207] - analysis using Anti-PPP1R7 antibody NBP2-38207 (A) shows similar pattern to independent antibody.

Applications for PPP1R7 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPP1R7

Regulatory subunit of protein phosphatase 1

Alternate Names

Protein phosphatase 1 regulatory subunit 22, protein phosphatase 1 regulatory subunit 7, protein phosphatase 1, regulatory (inhibitor) subunit 7, protein phosphatase-1 regulatory subunit 7 alpha2, protein phosphatase-1 regulatory subunit 7 beta1, protein phosphatase-1 regulatory subunit 7 beta2, regulatory subunit 7, sds22

Gene Symbol

PPP1R7

UniProt

Product Documents for PPP1R7 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PPP1R7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...