Skip to main content

PEX6 Antibody (3G3)

Catalog # H00005190-M04 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
H00005190-M04

Key Product Details

Species Reactivity

Human

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3G3

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for PEX6 Antibody (3G3)

Immunogen

PEX6 (NP_000278, 881 a.a. ~ 980 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC

Specificity

PEX6 - peroxisomal biogenesis factor 6 (3G3)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for PEX6 Antibody (3G3)

Western Blot: PEX6 Antibody (3G3) [H00005190-M04] - Analysis of PEX6 expression in K-562 (Cat # L009V1).
ELISA: PEX6 Antibody (3G3) [H00005190-M04] - Detection limit for recombinant GST tagged PEX6 is approximately 0.3ng/ml as a capture antibody.

Applications for PEX6 Antibody (3G3)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PEX6

This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6. [provided by RefSeq]

Alternate Names

PAF2, PAF-2peroxisome assembly factor 2, Peroxin-6, peroxisomal biogenesis factor 6peroxin-6, Peroxisomal-type ATPase 1, peroxisome biogenesis factor 6, PXAAA1peroxisomal AAA-type ATPase 1

Entrez Gene IDs

5190 (Human)

Gene Symbol

PEX6

Product Documents for PEX6 Antibody (3G3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PEX6 Antibody (3G3)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...