Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

PERK Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-80930

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-80930
NBP1-80930-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Chicken

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for PERK Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGNDE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%), Chicken reported in scientific publication (PMID: 32587659).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PERK Antibody

Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Analysis in human parathyroid gland and liver tissues using NBP1-80930 antibody. Corresponding EIF2AK3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human Colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PERK Antibody [NBP1-80930] - Staining of human parathyroid gland shows strong cytoplasmic and membranous positivity in glandular cells.

Applications for PERK Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

-Reported in scientific publication (PMID: 23103912)

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

-Reported in scientific publication( PMID: 32587659)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 3 publications using NBP1-80930 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PERK

The activation of signal transduction pathways by growth factors, hormones and neurotransmitters is mediated through two closely related MAP kinases, p44 and p42, designated extracellular-signal related kinase 1 (ERK 1) and ERK 2, respectively. ERK proteins are regulated by dual phosphorylation at Tyrosine 204 and 187 and Threonine 177 and 160 residues mapping within a characteristic Thr-Glu-Tyr motif. Phosphorylation at both the Threonine 202 and Tyrosine 204 residues of ERK 1 and Threonine 185 and Tyrosine 187 residues of ERK 2 is required for full enzymatic activation. The structural consequences of dual phosphorylation in ERK 2 include active site closure, alignment of key catalytic residues that interact with ATP, and remodeling of the activation loop. In response to activation, MAP kinases phosphorylate downstream components on serine and threonine. Upstream MAP kinase regulators include MAP kinase kinase (MEK), MEK kinase and Raf-1. The ERK family has three additional members: ERK 3, ERK 5 and ERK 6.

Long Name

Eukaryotic Translation Initiation Factor 4B

Alternate Names

EIF2AK3, PEK, WRS

Entrez Gene IDs

9451 (Human)

Gene Symbol

EIF2AK3

UniProt

Additional PERK Products

Product Documents for PERK Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PERK Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...