Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

PERK Antibody (7B10), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00009451-M03-100ug

Catalog #
Availability
Size / Price
Qty
Loading...
H00009451-M03-100ug

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 7B10

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for PERK Antibody (7B10)

Immunogen

EIF2AK3 (NP_002437, 665 a.a. ~ 764 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDS

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for PERK Antibody (7B10)

Sandwich ELISA: PERK Antibody (7B10) [H00009451-M03-100ug] - Detection limit for recombinant GST tagged EIF2AK3 is 0.03 ng/ml as a capture antibody.

Applications for PERK Antibody (7B10)

Application
Recommended Usage

ELISA

1:100-1:2000

Western Blot

1:100-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PERK

The activation of signal transduction pathways by growth factors, hormones and neurotransmitters is mediated through two closely related MAP kinases, p44 and p42, designated extracellular-signal related kinase 1 (ERK 1) and ERK 2, respectively. ERK proteins are regulated by dual phosphorylation at Tyrosine 204 and 187 and Threonine 177 and 160 residues mapping within a characteristic Thr-Glu-Tyr motif. Phosphorylation at both the Threonine 202 and Tyrosine 204 residues of ERK 1 and Threonine 185 and Tyrosine 187 residues of ERK 2 is required for full enzymatic activation. The structural consequences of dual phosphorylation in ERK 2 include active site closure, alignment of key catalytic residues that interact with ATP, and remodeling of the activation loop. In response to activation, MAP kinases phosphorylate downstream components on serine and threonine. Upstream MAP kinase regulators include MAP kinase kinase (MEK), MEK kinase and Raf-1. The ERK family has three additional members: ERK 3, ERK 5 and ERK 6.

Long Name

Eukaryotic Translation Initiation Factor 4B

Alternate Names

EIF2AK3, PEK, WRS

Entrez Gene IDs

9451 (Human)

Gene Symbol

EIF2AK3

OMIM

226980 (Human)

Additional PERK Products

Product Documents for PERK Antibody (7B10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PERK Antibody (7B10)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...