Skip to main content

PANP/PILR alpha associated neural protein Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90541

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90541
NBP1-90541-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PANP/PILR alpha associated neural protein Antibody - BSA Free (NBP1-90541) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PANP/PILR alpha associated neural protein Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PANP/PILR alpha associated neural protein Antibody - BSA Free

PANP/PILR alpha associated neural protein Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]

Immunocytochemistry/ Immunofluorescence: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]

Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
PANP/PILR alpha associated neural protein Antibody - BSA Free Immunohistochemistry: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]

Immunohistochemistry: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]

Analysis in human cerebral cortex and liver tissues using NBP1-90541 antibody. Corresponding PIANP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]

Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]

Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Applications for PANP/PILR alpha associated neural protein Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PANP

Long Name

PILR alpha Associated Neural Protein

Alternate Names

C12orf53, PIANP

Gene Symbol

PIANP

Additional PANP Products

Product Documents for PANP/PILR alpha associated neural protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PANP/PILR alpha associated neural protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...
Loading...