Skip to main content

PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16543

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16543-100ul
NBP3-16543-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6H7X3 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PA28 Activator alpha Subunit/PSME1 (NP_006254.1). MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3) (NBP3-16543) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3)

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3) [NBP3-16543]

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3) [NBP3-16543]

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3) [NBP3-16543] - Western blot analysis of extracts of various cell lines, using PA28 Activator alpha Subunit/PSME1 Rabbit mAb (NBP3-16543) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PA28 Activator alpha Subunit

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Two transcripts encoding different isoforms have been identified.

Long Name

Proteasome (Prosome, Macropain) Activator Subunit 1

Alternate Names

11S Regulator Complex Subunit alpha, IFI5111, PSME1, REG alpha

Gene Symbol

PSME1

Additional PA28 Activator alpha Subunit Products

Product Documents for PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...