Skip to main content

P2Y12/P2RY12 Antibody

Catalog # NBP2-33870 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33870
NBP2-33870-25ul

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Canine, Feline

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Frozen, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for P2Y12/P2RY12 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Reactivity Notes

Feline, Canine reactivity reported from verified customer reviews.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for P2Y12/P2RY12 Antibody

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining in human cerebral cortex and liver tissues . Corresponding P2RY12 RNA-seq data are presented for the same tissues.
Western Blot: P2Y12/P2RY12 Antibody [NBP2-33870] - Quantitative biochemical measurements of P2Y12/P2RY12 protein and mRNA in human brains. Western blot measurements of P2Y12/P2RY12 levels in MTG samples from LP, HP and AD brains. Representative western blot image of P2Y12/P2RY12 polypeptide of MTG protein extracts identified with Novus antibody. Blots were normalized for levels of beta actin. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/1422-0067/21/2/678), licensed under a CC-BY license.
Immunocytochemistry/Immunofluorescence: P2Y12/P2RY12 Antibody [NBP2-33870] - Green-P2Y12/P2RY12, Blue-DAPI. 1:200 dilution for fixed tissue sections of feline optical nerve. ICC/IF image submitted by a verified customer review.

Applications for P2Y12/P2RY12 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

-validated from a verified customer review

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Frozen

-validated from a verified customer review

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

- reported in scientific literature (PMID:31968618).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 3 reviews rated 3.3 using NBP2-33870 in the following applications:

Published Applications

Read 9 publications using NBP2-33870 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: P2Y12/P2RY12

P2Y12 is a Purinergic Receptor essential for the aggregation of blood platelets. There is evidence that mutations in P2Y12 cause a bleeding disorder, suggesting that knowledge of the P2Y12 receptor could advance the development of antiplatelet agents to treat cardiovascular diseases. Expression of P2Y12 has been reported in platelets, spinal cord, and many brain regions. ESTs for P2Y12 have been isolated from B-cell/lung/testis, brain, embryo, prostate, eye, kidney carcinoma, and colon carcinoma libraries. Cognate

Long Name

P2Y Purinergic Receptor 12

Alternate Names

ADPG-R, HORK3, P2RY12, SP1999

Gene Symbol

P2RY12

Product Documents for P2Y12/P2RY12 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for P2Y12/P2RY12 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...