Skip to main content

OXR1 Antibody

Catalog # NBP1-86391 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86391
NBP1-86391-25ul

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for OXR1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDIDQLSGRDFCHSKKMTGSNTEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OXR1 Antibody

Western Blot: OXR1 Antibody [NBP1-86391] - Analysis in control (vector only transfected HEK293T lysate) and OXR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: OXR1 Antibody [NBP1-86391] - Staining of human cell line A-431 shows positivity in vesicles.
Immunohistochemistry-Paraffin: OXR1 Antibody [NBP1-86391] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Applications for OXR1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OXR1

Oxidation resistance 1 (OXR1) protein was originally identified in a screen for human genes that function to protect cells from oxidative damage. OXR1 localizes to the mitochondria, and its expression has been shown to be induced by heat and oxidative stress.

Alternate Names

FLJ10125, FLJ38829, FLJ40849, FLJ41673, FLJ42450, FLJ45656, oxidation resistance 1, oxidation resistance protein 1, putative protein product of Nbla00307

Gene Symbol

OXR1

Product Documents for OXR1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for OXR1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...