Osteocalcin Antibody (190125) [Alexa Fluor® 532]
Novus Biologicals, part of Bio-Techne | Catalog # FAB1419X
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Concentration
Product Specifications
Immunogen
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Specificity
Clonality
Host
Isotype
Description
For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Applications for Osteocalcin Antibody (190125) [Alexa Fluor® 532]
CyTOF-ready
Immunocytochemistry
Immunohistochemistry
Intracellular Staining by Flow Cytometry
Spectra Viewer
Plan Your Experiments
Use our spectra viewer to interactively plan your experiments, assessing multiplexing options. View the excitation and emission spectra for our fluorescent dye range and other commonly used dyes.
Spectra ViewerFormulation, Preparation, and Storage
Purification
Formulation
Preservative
Concentration
Shipping
Stability & Storage
Background: Osteocalcin
Long Name
Alternate Names
Gene Symbol
Additional Osteocalcin Products
Product Documents for Osteocalcin Antibody (190125) [Alexa Fluor® 532]
Product Specific Notices for Osteocalcin Antibody (190125) [Alexa Fluor® 532]
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.