Skip to main content

NONO Antibody

Catalog # NBP2-38716 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38716
NBP2-38716-25ul

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for NONO Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG

Predicted Species

Mouse (99%), Rat (97%). Backed by our 100% Guarantee.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NONO Antibody

Western Blot: NONO Antibody [NBP2-38716] - Analysis using Anti-NONO antibody NBP2-38716 (A) shows similar pattern to independent antibody NBP2-38727 (B).
Immunocytochemistry/Immunofluorescence: NONO Antibody [NBP2-38716] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716] - Staining of human kidney.

Applications for NONO Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NONO

Non-POU-domain-containing octamer binding protein (NONO) is a member of the DBHS (drosophila behavior, human splicing) domain-containing family and is an RNA- and DNA- binding protein. NONO and other DBHS domain-containing proteins are multifunctional and are reported to be involved in transcriptional regulation, mRNA processing, and DNA non-homologous end joining (NHEJ). NONO functions as a coregulator of the androgen receptor (AR) and also regulates cAMP transcriptional activity by interacting with gene promoter elements. NONO is also involved in pre-mRNA splicing through an interaction with U5 snRNA and can stimulate DNA nonhomologous end joining (NHEJ) through the interaction with ku70/G22p and ku80/XRCC5 dimers. Alternate names for NONO include 54 kDa nuclear RNA- and DNA-binding protein, p54 (nrb), 55 kDa nuclear protein, NMT55, DNA-binding p52/p100 complex, NRB54, P54, and P54NRB.

Alternate Names

NMT5552 kDa subunit, non-POU domain containing, octamer-binding, NRB54non-POU-domain-containing, octamer-binding, p54(nrb)

Gene Symbol

NONO

UniProt

Product Documents for NONO Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NONO Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...