NOD1 Antibody [Biotin]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-77043

Fc Region Site-Specific Biotinylated Antibody
Catalog #
Availability
Size / Price
Qty
NBP3-77043
Print Quote
Bulk Order
Forumulation
Catalog #
BSA Free
NBP2-57631
View Product
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.1 mg/ml

View all NOD1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE

Reactivity Notes

Mouse 86%, Rat 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for NOD1 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: NOD1

Innate immunity is present in all animals and is the common mode of defense against microorganisms. It detects microorganisms by specific proteins called pattern-recognition molecules (PRMs) (reviewed in Werts et al. 2006). There is a limited set of PRMs in each animal genome, and it has been postulated that the PRMs were evolutionarily selected to detect conserved components or motifs of microorganisms called pathogen-associated molecular patterns (PAMPs). PAMPs are found in a wide range of microorganisms and recognition of PAMPs by PRMs activates inflammatory signaling pathways, thereby stimulating an immune response. NOD (nucleotide-binding oligomerization domain) proteins are a family of cytosolic proteins which have been implicated in innate recognition of bacteria, the induction of inflammatory responses, and the regulation of caspase activation and apoptosis. NOD1/CARD4 (caspase-recruitment domain 4 gene) is a PRM that recognizes specific peptidoglycan (PGN) components of bacterial cell walls (reviewed in Strober et al. 2006, and Inohara et al. 2003). NOD1 is expressed by cell types that are exposed to PGN under physiological conditions including antigen-presenting cells (APCs) such as macrophages and dendritic cells, and epithelial cells (reviewed in Strober et al. 2006). NOD1 is thought to play a role in the pathogenesis of human gastrointestinal disease and is associated with inflammatory bowel diseases and asthma. It is involved in host defense against Helicobacter pylori infection of the gastric mucosa, a chronic infection that can lead to peptic ulcers and gastric cancer. This antibody recognizes NOD1/CARD4. Human NOD1/CARD4 is a 953 amino acid protein.

Long Name

Nucleotide-binding Oligomerization Domain-containing Protein 1

Alternate Names

CARD4, CLR7.1, NLRC1

Gene Symbol

NOD1

Additional NOD1 Products

Product Documents for NOD1 Antibody [Biotin]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOD1 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy Policy
Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved. All trademarks and registered trademarks are the property of Bio-Techne and its brands unless otherwise specified.