Skip to main content

Neuroligin 4Y/NLGN4Y Antibody (1E4)

Catalog # H00022829-M01 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
H00022829-M01

Key Product Details

Species Reactivity

Human

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1E4

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Neuroligin 4Y/NLGN4Y Antibody (1E4)

Immunogen

NLGN4Y (AAH32567, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF

Specificity

NLGN4Y - neuroligin 4, Y-linked

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for Neuroligin 4Y/NLGN4Y Antibody (1E4)

ELISA: Neuroligin 4Y/NLGN4Y Antibody (1E4) [H00022829-M01] - Neuroligin 4 Y-Linked Antibody (1E4) [H00022829-M01] - Detection limit for recombinant GST tagged NLGN4Y is approximately 0.1ng/ml as a capture antibody.

Applications for Neuroligin 4Y/NLGN4Y Antibody (1E4)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Neuroligin 4Y/NLGN4Y

Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM]

Long Name

Neuroligin 4, Y-Linked

Alternate Names

Neuroligin Y, NLGN4Y

Entrez Gene IDs

22829 (Human)

Gene Symbol

NLGN4Y

OMIM

400028 (Human)

Product Documents for Neuroligin 4Y/NLGN4Y Antibody (1E4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Neuroligin 4Y/NLGN4Y Antibody (1E4)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...