Skip to main content

NDUFA3 Antibody

Catalog # NBP2-85364 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-85364-0.1ml

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for NDUFA3 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse NDUFA3. Peptide sequence: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NDUFA3 Antibody

Western Blot: NDUFA3 Antibody [NBP2-85364] - Host: Rabbit. Target Name: Ndufa3. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Applications for NDUFA3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFA3

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

B9, CI-B9, complex I B9 subunit, Complex I-B9, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3, NADH-ubiquinone oxidoreductase B9 subunit

Gene Symbol

NDUFA3

Product Documents for NDUFA3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NDUFA3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...