Skip to main content

NDST4 Antibody

Catalog # NBP1-86481 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86481
NBP1-86481-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for NDST4 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GYKQEMTLIETTAEAECTDIKILPYRSMELKTVKPIDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQ

Predicted Species

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDST4 Antibody

Immunohistochemistry-Paraffin: NDST4 Antibody [NBP1-86481] - Staining of human pancreas shows distinct cytoplasmic positivity in interlobular ducts.

Applications for NDST4 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDST4

Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine(GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backboneto make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has lowdeacetylase activity but high sulfotransferase activity

Alternate Names

bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 4, HSST4, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4, NDST-4, N-heparan sulfate sulfotransferase 4, N-HSST 4, NHSST4

Gene Symbol

NDST4

Product Documents for NDST4 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NDST4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...