Skip to main content

NAV2 Antibody (4D11)

Catalog # H00089797-M01 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
H00089797-M01

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4D11

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for NAV2 Antibody (4D11)

Immunogen

NAV2 (NP_892009.2, 1878 a.a. ~ 1973 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS

Specificity

NAV2 - neuron navigator 2 (4D11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for NAV2 Antibody (4D11)

Sandwich ELISA: NAV2 Antibody (4D11) [H00089797-M01] - Detection limit for recombinant GST tagged NAV2 is 0.3 ng/ml as a capture antibody.

Applications for NAV2 Antibody (4D11)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NAV2

The vitamin A metabolite, all-trans retinoic acid (atRA), plays an important role in neuronal development, including neurite outgrowth. RAINB1 is an atRA-responsive gene.[supplied by OMIM]

Alternate Names

EC 3.6.4.12, FLJ10633, FLJ11030, FLJ23707, HELAD1UNC53H2, Helicase APC down-regulated 1, KIAA1419STEERIN2, neuron navigator 2, POMFIL2helicase, APC down-regulated 1, pore membrane and/or filament interacting like protein 2, Pore membrane and/or filament-interacting-like protein 2, RAINB1FLJ77876, retinoic acid inducible gene in neuroblastoma 1, Retinoic acid inducible in neuroblastoma 1, steerin-2, Unc-53 homolog 2, unc53H2

Entrez Gene IDs

89797 (Human)

Gene Symbol

NAV2

Product Documents for NAV2 Antibody (4D11)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NAV2 Antibody (4D11)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...