Skip to main content

NAP1L3 Antibody - BSA Free

Catalog # NBP3-04950 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-04950-100ul
NBP3-04950-20ul

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for NAP1L3 Antibody - BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 307-506 of human NAP1L3 (NP_004529.2). DPKGIPDYWLIVLKNVDKLGPMIQKYDEPILKFLSDVSLKFSKPGQPVSYTFEFHFLPNPYFRNEVLVKTYIIKAKPDHNDPFFSWGWEIEDCKGCKIDWRRGKDVTVTTTQSRTTATGEIEIQPRVVPNASFFNFFSPPEIPMIGKLEPREDAILDEDFEIGQILHDNVILKSIYYYTGEVNGTYYQFGKHYGNKKYRK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications for NAP1L3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NAP1L3

NAP1L3 encodes a member of the nucleosome assembly protein (NAP) family. It is linked closely to a region of genes responsible for several X-linked mental retardation syndromes. Alternatively spliced transcript variants have been found for this gene, but the biological validity of the variants has not been determined. [provided by RefSeq]

Alternate Names

BNAP, MB20, MGC26312, NPL3, nucleosome assembly protein 1-like 3

Gene Symbol

NAP1L3

Product Documents for NAP1L3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NAP1L3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...