Skip to main content

Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Catalog # NBP1-87466 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87466
NBP1-87466-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry Free-Floating, Immunohistochemistry-Frozen, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31785263). Use in Rat reported in scientific literature (PMID:31785263).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining in human cerebral cortex and pancreas tissues using anti-CHRM1 antibody. Corresponding CHRM1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of dissociated rat hippocampal culture. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human cerebral cortex shows high expression.

Applications for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

-Validated from a verified customer review.

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry Free-Floating

-Reported in scientific literature (PMID: 31785263).

Immunohistochemistry-Frozen

-Reported in scientific literature (PMID: 24658304).

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

-Reported in scientific literature (PMID: 24658304).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 1 review rated 4 using NBP1-87466 in the following applications:

Published Applications

Read 4 publications using NBP1-87466 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHRM1

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13.

Long Name

Cholinergic Receptor Muscarinic 1

Alternate Names

HM1, M1, M1R, mAChR M1

Gene Symbol

CHRM1

Product Documents for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...