Skip to main content

MTHFD1L Antibody

Catalog # NBP2-37864 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-37864
NBP2-37864-25ul

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MTHFD1L Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HFGGLIEEDDVILLAAALRIQNMVSSGRRWLREQQHRRWRLHCLKLQPLSPVPSDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%) Use in Mouse reported in scientific literature (PMID:31920982).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MTHFD1L Antibody

Western Blot: MTHFD1L Antibody [NBP2-37864] - Analysis using Anti-MTHFD1L antibody NBP2-37864 (A) shows similar pattern to independent antibody NBP2-37863 (B).
Immunohistochemistry-Paraffin: MTHFD1L Antibody [NBP2-37864] - Staining in human placenta and skeletal muscle tissues.. Corresponding MTHFD1L RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MTHFD1L Antibody [NBP2-37864] - Staining of human skeletal muscle shows weak positivity in myocytes.

Applications for MTHFD1L Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP2-37864 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTHFD1L

MTHFD1L, also known as Monofunctional C1-tetrahydrofolate synthase, mitochondrial, consists of 2 a 978 amino acid isoform1 that is 106 kDa and a 275 amino acid isoform 2 that is 30 kDa; has mitochondrion subcellular location and highest expression found in placenta, thymus and brain; it is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion which is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine, and also may provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. Current research is being performed on this protein involvement in cleft lip/palate, neural tube defect, homocysteine, coronary heart disease, chronic myeloid leukemia, Down syndrome, colon adenocarcinoma, nephropathy, Alzheimer's disease, dementia, colorectal cancer, leukemia, and atherosclerosis. This protein plays role in One carbon pool by folate and Metabolic pathways where it interacts with CASP4, MAGED1, WRAP73, WDR8, MAP1LC3A, and plus more than 40 other proteins.

Alternate Names

10-formyl-THF synthetase, dJ292B18.2, DKFZP586G1517, EC 6.3.4.3, FLJ21145, Formyltetrahydrofolate synthetase, formyltetrahydrofolate synthetase domain containing 1, FTHFSDC1, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, mitochondrial C1-tetrahydrofolate synthase, mitochondrial C1-tetrahydrofolate synthetase, monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS

Gene Symbol

MTHFD1L

UniProt

Product Documents for MTHFD1L Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MTHFD1L Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...