Skip to main content

MTCP1 Antibody (1G12)

Catalog # H00004515-M05 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
H00004515-M05

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 1G12

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MTCP1 Antibody (1G12)

Immunogen

MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK

Specificity

MTCP1 - mature T-cell proliferation 1 (1G12)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MTCP1 Antibody (1G12)

Western Blot: MTCP1 Antibody (1G12) [H00004515-M05] - Analysis of MTCP1 expression in transfected 293T cell line by MTCP1 monoclonal antibody (M05), clone 1G12. Lane 1: MTCP1 transfected lysate (Predicted MW: 7.7 KDa). Lane 2: Non-transfected lysate.
Sandwich ELISA: MTCP1 Antibody (1G12) [H00004515-M05] - Detection limit for recombinant GST tagged MTCP1 is 0.1 ng/ml as a capture antibody.

Applications for MTCP1 Antibody (1G12)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MTCP1

This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. The gene has two ORFs that encode two different proteins. The upstream ORF encodes a 13kDa protein that is a member of the TCL1 family; this protein may be involved in leukemogenesis. The downstream ORF encodes an 8kDa protein that localizes to mitochondria. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Alternate Names

mature T-cell proliferation 1, P13MTCP1

Entrez Gene IDs

4515 (Human)

Gene Symbol

MTCP1

Product Documents for MTCP1 Antibody (1G12)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MTCP1 Antibody (1G12)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...