Skip to main content

MSX2 Antibody (1F6)

Catalog # H00004488-M04 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
H00004488-M04

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1F6

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MSX2 Antibody (1F6)

Immunogen

MSX2 (NP_002440, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL*

Specificity

MSX2 (1F6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MSX2 Antibody (1F6)

Immunocytochemistry/Immunofluorescence: MSX2 Antibody (1F6) [H00004488-M04] - Analysis of monoclonal antibody to MSX2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: MSX2 Antibody (1F6) [H00004488-M04] - Analysis of monoclonal antibody to MSX2 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml

Applications for MSX2 Antibody (1F6)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using H00004488-M04 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MSX2

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2.

Long Name

Msh Homeobox 2

Alternate Names

CRS2, FPP, Hox8, MSH, PFM1

Entrez Gene IDs

4488 (Human)

Gene Symbol

MSX2

OMIM

123101 (Human)

Product Documents for MSX2 Antibody (1F6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MSX2 Antibody (1F6)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...