Skip to main content

MOX1 Antibody

Catalog # NBP1-92134 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-92134
NBP1-92134-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MOX1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: WGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MOX1 Antibody

Immunohistochemistry-Paraffin: MOX1 Antibody [NBP1-92134] - Staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in Purkinje cells.

Applications for MOX1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF reactivity reported in scientific literature (PMID:24098972)
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP1-92134 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MOX1

MOX1 encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

homeobox protein MOX-1, mesenchyme homeobox 1MOX1mesenchyme homeo box 1

Entrez Gene IDs

4222 (Human)

Gene Symbol

MEOX1

UniProt

Product Documents for MOX1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MOX1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...