Skip to main content

METTL26 Antibody

Catalog # NBP2-85272 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-85272-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for METTL26 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human METTL26. Peptide sequence: PLAEWQPSDVDQRCLDSIAATTQAQGLTNVKAPLHLDVTWGWEHWGGILP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for METTL26 Antibody

Western Blot: METTL26 Antibody [NBP2-85272] - Host: Rabbit. Target Name: C16orf13. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for METTL26 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: METTL26

Alternate Names

chromosome 16 open reading frame 13, hypothetical protein LOC84326, JFP2, MGC13114

Gene Symbol

C16ORF13

Product Documents for METTL26 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for METTL26 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...