Skip to main content

MEST Antibody - BSA Free

Catalog # NBP3-04728 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-04728-100ul
NBP3-04728-20ul

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for MEST Antibody - BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 146-335 of human MEST (NP_002393.2). HDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTLPRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MEST Antibody - BSA Free

Western Blot: MEST Antibody [NBP3-04728] - Analysis of extracts of various cell lines, using MEST antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunocytochemistry/Immunofluorescence: MEST Antibody [NBP3-04728] - Analysis of U2OS cells using MEST antibody . Blue: DAPI for nuclear staining.

Applications for MEST Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Western Blot

1:1000 - 1:5000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MEST

MEST encodes a member of the [alpha]/[beta] hydrolase fold family and has isoform specific imprinting. The loss of imprinting of this gene has been linked to certain types of cancer and may be due to promotor switching. The encoded protein may play a role in development. Three transcript variants encoding two distinct isoforms have been identified for this gene. A pseudogene for this locus is located on chromosome 6. [provided by RefSeq]

Alternate Names

DKFZp686L18234, EC 3.-, mesoderm specific transcript (mouse) homolog, mesoderm specific transcript homolog (mouse), mesoderm-specific transcript homolog protein, MGC111102, MGC8703, paternally expressed gene 1, PEG1Paternally-expressed gene 1 protein

Gene Symbol

MEST

Product Documents for MEST Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MEST Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...