Skip to main content

MBOAT2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83185

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83185-0.1ml

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat MBOAT2. Peptide sequence: GMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit MBOAT2 Antibody - BSA Free (NBP2-83185) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for MBOAT2 Antibody - BSA Free

Western Blot: MBOAT2 Antibody [NBP2-83185]

Western Blot: MBOAT2 Antibody [NBP2-83185]

Western Blot: MBOAT2 Antibody [NBP2-83185] - Host: Rabbit. Target Name: Mboat2. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml
MBOAT2 Antibody - BSA Free

Western Blot: MBOAT2 Antibody - BSA Free [NBP2-83185] -

YB60 modulates ferroptosis and the AR/Mboat2 axis in Spinal Cord Neurons. (A) Fluorescence double-label staining of AR (green) and c-Fos (red) in the Sham (a1, a4), CCI (a2, a5) and CCI + YB60-H (a3, a6) groups. DAPI (blue) staining highlights nuclei. Scale bars: 500 μm (a1- a3); 100 μm (a4- a6). (B) Fluorescence double-label staining of Mboat2 (green) and c-Fos (red) in the sham (b1, b4), CCI (b2, b5) and CCI + YB60-H (b3, b6) groups. DAPI (blue) staining highlights nuclei. Scale bars: 500 μm (b1- b3); 100 μm (b4- b6). (C) Expression levels of AR and Mboat2. (D-E) Semiquantitative analysis of AR (D) and Mboat2 (E), n = 3. The error bars represent the SD. **P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40201699), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MBOAT2 Antibody - BSA Free

Western Blot: MBOAT2 Antibody - BSA Free [NBP2-83185] -

YB60 inhibited Erastin-induced ferroptosis by regulating AR/Mboat2 in PC12 cells. (A) Expression levels of AR and Mboat2 in PC12 cells. (B-C) Semiquantitative analysis of AR (B) and Mboat2 (C), n = 3. D-F. Contents of iron ions (D), ROS (E) and MDA (F) in various groups, n = 6. (G) Viability of PC12 cells. The error bars represent the SD. **P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40201699), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MBOAT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MBOAT2

Acyltransferase which mediates the conversion of lysophosphatidylethanolamine(1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine(1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidicacid (LPA) into phosphatidic acid (PA) (LPAAT activity). Has also a very weak lysophosphatidylcholine acyltransferase(LPCAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze thereacylation step of the phospholipid remodeling pathway also known as the Lands cycle

Alternate Names

1-acylglycerophosphate O-acyltransferase, EC 2.3.1.-, EC 2.3.1.51, EC 2.3.1.n7,1-acylglycerophosphoethanolamine O-acyltransferase, FLJ14415, FLJ90298, LPAAT, LPCAT4, LPEAT, LPLAT 2, Lyso-PA acyltransferase, Lyso-PE acyltransferase, Lysophosphatidic acid acyltransferase, Lysophosphatidylethanolamine acyltransferase, lysophospholipid acyltransferase 2, membrane bound O-acyltransferase domain containing 2, Membrane-bound O-acyltransferase domain-containing protein 2, OACT2, O-acyltransferase (membrane bound) domain containing 2, O-acyltransferase domain-containing protein 2

Gene Symbol

MBOAT2

Additional MBOAT2 Products

Product Documents for MBOAT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MBOAT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...