Skip to main content

Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody

Catalog # NBP2-57484 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57484
NBP2-57484-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK

Predicted Species

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody

Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody [NBP2-57484] - Staining of human cell line A-431 shows localization to nucleoplasm.

Applications for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lysine (K)-specific Demethylase 4C/KDM4C

JMJD2C is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein with one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma.

Alternate Names

GASC1, JHDM3C, JMJD2C, KDM4C, Lysine (K)specific Demethylase 4C

Gene Symbol

KDM4C

Product Documents for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...