LEUTX Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90890
Key Product Details
Species Reactivity
Human
Applications
Validated:
Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSW
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for LEUTX Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: LEUTX Antibody [NBP1-90890]
Immunocytochemistry/Immunofluorescence: LEUTX Antibody [NBP1-90890] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.Chromatin Immunoprecipitation-exo-Seq: LEUTX Antibody - BSA Free [NBP1-90890]
ChIP-Exo-Seq composite graph for Anti-LEUTX (NBP1-90890) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Immunocytochemistry/ Immunofluorescence: LEUTX Antibody - BSA Free [NBP1-90890] -
LEUTX expression in human preimplantation embryos and pluripotent stem cells. (A) Indirect immunolabeling in nuclei (blue) indicates LEUTX expression (red) in the human 8-cell embryo (n=3). Scale bar: 20 um. (B) STRT sequencing of single cells from human 8-cell blastomeres (n=14) and two hESC lines (HS983a and HS980, n=15 for each). The TSS-specific reads from LEUTX.n show low or undetectable expression in hESCs, but detectable expression in 8-cell blastomeres. ND, not detected. (C) qPCR validation in three hESC lines and an independent 8-cell embryo library. Expression was detected in all studied cell lines (n=3), but only in one replicate for HS980. (D-F) LEUTX expression in Yan et al. (2013), Xue et al. (2013) and Petropoulos et al. (2016) data, all supporting LEUTX expression in 4- and 8-cell embryos and downregulation in the morula/blastocyst. (F) Day 3 to day 7 refer to embryos from the 8-cell stage to late blastocyst. (G) FANTOM5 data for LEUTX (n=1829). Only six iPSC samples contained tag clusters in the LEUTX region. The average expression refers to the FANTOM5 CAGE phase 1 and 2 samples in which expression was detected. (H) Human somatic fibroblasts from amniotic mesoderm (n=3) were used to generate human iPSCs (hiPS, n=15) (GEO dataset GSE20750, probe 42402). LEUTX shows higher expression in human iPSCs. (I) hESCs (n=4) were differentiated into cardiomyocytes (n=4) and analyzed by RNA expression array (GEO dataset GSE13834, probe 42402). LEUTX was expressed in hESCs, but not in differentiated cardiomyocytes. LEUTX is detected by Agilent 014850 Whole Human Genome Microarray 4x44K G4112F (H,I). Error bars indicate mean+/-s.e.m.; all comparisons for G-I are statistically significant (Student's t-test, P=0.05). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/27578796), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for LEUTX Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LEUTX
Alternate Names
arginine-fifty homeobox-like pseudogene, leucine twenty homeobox, leucine-twenty homeobox, putative leucine-twenty homeobox
Gene Symbol
LEUTX
Additional LEUTX Products
Product Documents for LEUTX Antibody - BSA Free
Product Specific Notices for LEUTX Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...