Skip to main content

LEUTX Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90890

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90890-25ul
NBP1-90890

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LEUTX Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LEUTX Antibody [NBP1-90890]

Immunocytochemistry/ Immunofluorescence: LEUTX Antibody [NBP1-90890]

Immunocytochemistry/Immunofluorescence: LEUTX Antibody [NBP1-90890] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.
LEUTX Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: LEUTX Antibody - BSA Free [NBP1-90890]

Chromatin Immunoprecipitation-exo-Seq: LEUTX Antibody - BSA Free [NBP1-90890]

ChIP-Exo-Seq composite graph for Anti-LEUTX (NBP1-90890) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
LEUTX Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LEUTX Antibody - BSA Free [NBP1-90890] -

LEUTX expression in human preimplantation embryos and pluripotent stem cells. (A) Indirect immunolabeling in nuclei (blue) indicates LEUTX expression (red) in the human 8-cell embryo (n=3). Scale bar: 20 um. (B) STRT sequencing of single cells from human 8-cell blastomeres (n=14) and two hESC lines (HS983a and HS980, n=15 for each). The TSS-specific reads from LEUTX.n show low or undetectable expression in hESCs, but detectable expression in 8-cell blastomeres. ND, not detected. (C) qPCR validation in three hESC lines and an independent 8-cell embryo library. Expression was detected in all studied cell lines (n=3), but only in one replicate for HS980. (D-F) LEUTX expression in Yan et al. (2013), Xue et al. (2013) and Petropoulos et al. (2016) data, all supporting LEUTX expression in 4- and 8-cell embryos and downregulation in the morula/blastocyst. (F) Day 3 to day 7 refer to embryos from the 8-cell stage to late blastocyst. (G) FANTOM5 data for LEUTX (n=1829). Only six iPSC samples contained tag clusters in the LEUTX region. The average expression refers to the FANTOM5 CAGE phase 1 and 2 samples in which expression was detected. (H) Human somatic fibroblasts from amniotic mesoderm (n=3) were used to generate human iPSCs (hiPS, n=15) (GEO dataset GSE20750, probe 42402). LEUTX shows higher expression in human iPSCs. (I) hESCs (n=4) were differentiated into cardiomyocytes (n=4) and analyzed by RNA expression array (GEO dataset GSE13834, probe 42402). LEUTX was expressed in hESCs, but not in differentiated cardiomyocytes. LEUTX is detected by Agilent 014850 Whole Human Genome Microarray 4x44K G4112F (H,I). Error bars indicate mean+/-s.e.m.; all comparisons for G-I are statistically significant (Student's t-test, P=0.05). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/27578796), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for LEUTX Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LEUTX

Alternate Names

arginine-fifty homeobox-like pseudogene, leucine twenty homeobox, leucine-twenty homeobox, putative leucine-twenty homeobox

Gene Symbol

LEUTX

Additional LEUTX Products

Product Documents for LEUTX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LEUTX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...