Skip to main content

KLF2 Antibody (1D12), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00010365-M09

Catalog #
Availability
Size / Price
Qty
Loading...
H00010365-M09

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1D12

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for KLF2 Antibody (1D12)

Immunogen

KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH

Specificity

Reacts with Kruppel-like factor 2 (lung).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for KLF2 Antibody (1D12)

Western Blot: KLF2 Antibody (1D12) [H00010365-M09] - Analysis of KLF2 expression in IMR-32.

Applications for KLF2 Antibody (1D12)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: KLF2

KLF2 binds to the CACCC box in the beta-globin gene promoter and activates transcription.

Long Name

Kruppel-Like Factor 2

Alternate Names

LKLF

Entrez Gene IDs

10365 (Human)

Gene Symbol

KLF2

Additional KLF2 Products

Product Documents for KLF2 Antibody (1D12)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KLF2 Antibody (1D12)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...