Skip to main content

KERA Antibody

Catalog # NBP1-84425 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84425
NBP1-84425-25ul

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for KERA Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25713466).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KERA Antibody

Immunohistochemistry-Paraffin: KERA Antibody [NBP1-84425] - Staining of human eye, cornea shows positivity in extracellular matrix.

Applications for KERA Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 25713466). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 2 publications using NBP1-84425 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Keratocan

KERA is a gene that codes for a protein that helps develop and maintain corneal transparency, as it is highly expressed in the cornea, as well as contributes to the structure of the stromal matrix that has a length of 352 amino acids and a weight of approximately 40.5 kDa. Studies are being conducted on severeal diseases and disorders relating to this gene, including cornea plana congenital, acrus senilis, keratopathy, corneal dystrophy, hyperopia, and glaucoma. KERA has also been shown to have interactions with CXCL2, B3GNT7, CHST1, CHST5, and CHST6 in pathways such as the MAroteaux-Lamy syndrome, metabolic, and Sanfilippo syndrome pathways.

Long Name

Keratocan

Alternate Names

KERA, SLRR2B

Gene Symbol

KERA

Product Documents for KERA Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KERA Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...