Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

ING1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-57223

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57223
NBP2-57223-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ING1 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ING1 Antibody

Immunocytochemistry/Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Applications for ING1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ING1

p33 ING1 is a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53-signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. The accession number listed below is for variant (4) that encodes the longest isoform (D). Other synonyms for p33 ING1 include p33, p47, p33ING1, p24ING1c, p33ING1b, p47ING1a, growth inhibitor ING1, inhibitor of growth 1, tumor suppressor ING1 and growth inhibitory protein ING1.

Long Name

Inhibitor of Growth 1

Alternate Names

p24ING1c, p33ING1b, p47ING1a

Gene Symbol

ING1

Additional ING1 Products

Product Documents for ING1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ING1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...