Skip to main content

IL-18 BPa/IL18BP Antibody (2A9), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00010068-M05

Catalog #
Availability
Size / Price
Qty
Loading...
H00010068-M05

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2A9

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for IL-18 BPa/IL18BP Antibody (2A9)

Immunogen

IL18BP (AAH44215, 31 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Specificity

interleukin 18 binding protein

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for IL-18 BPa/IL18BP Antibody (2A9)

Western Blot: IL-18 BPa/IL18BP Antibody (2A9) [H00010068-M05] - IL18BP monoclonal antibody (M05), clone 2A9 Western Blot analysis of IL18BP expression in MCF-7 ( Cat # L046V1 ).
Western Blot: IL-18 BPa/IL18BP Antibody (2A9) [H00010068-M05] - IL18BP monoclonal antibody (M05), clone 2A9 Western Blot analysis of IL18BP expression in MCF-7 ( Cat # L046V1 ).
ELISA: IL-18 BPa/IL18BP Antibody (2A9) [H00010068-M05] - Detection limit for recombinant GST tagged IL18BP is approximately 3ng/ml as a capture antibody.

Applications for IL-18 BPa/IL18BP Antibody (2A9)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: IL-18 BPa

The protein encoded by this gene is an inhibitor of the proinflammatory cytokine IL18. This protein binds to IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production. This protein is constitutively expressed and secreted in mononuclear cells. The expression of this protein can be enhanced by IFN-gamma. An elevated level of this protein is detected in the intestinal tissues of patients with Crohn disease. Three transcript variants encoding the same protein have been found for this gene.

Long Name

Interleukin 18 Binding Protein Isoform a

Alternate Names

IL18 BPa, IL18BP

Entrez Gene IDs

10068 (Human)

Gene Symbol

IL18BP

OMIM

604113 (Human)

Additional IL-18 BPa Products

Product Documents for IL-18 BPa/IL18BP Antibody (2A9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IL-18 BPa/IL18BP Antibody (2A9)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...