Skip to main content

IFT172 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-83073

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83073-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for IFT172 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human IFT172. Peptide sequence: VKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IFT172 Antibody

Western Blot: IFT172 Antibody [NBP2-83073] - WB Suggested Anti-IFT172 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Lung

Applications for IFT172 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFT172

Alternate Names

DKFZp434A163, intraflagellar transport 172 homolog (Chlamydomonas), intraflagellar transport protein 172 homolog

Gene Symbol

IFT172

Additional IFT172 Products

Product Documents for IFT172 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IFT172 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...