Skip to main content

IFN-alpha WA/IFNA16 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-86674

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-86674-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for IFN-alpha WA/IFNA16 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFN-alpha WA/IFNA16. Peptide sequence: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IFN-alpha WA/IFNA16 Antibody

Western Blot: IFN-alpha WA/IFNA16 Antibody [NBP2-86674] - Host: Rabbit. Target Name: IFNA16. Sample Type: ACHN whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for IFN-alpha WA/IFNA16 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFNA16

IFNA16, also known as Interferon alpha-16, is a 189 amino acid protein that is 22 kDa, belongs to the alpha/beta interferon family, produced by macrophages has antiviral activities, and stimulates the production of protein kinase and oligoadenylate synthetase. Current research is being performed on several diseases and disorders including interferon, dengue hemorrhagic fever, immunodeficiency, hemorrhagic fever, autoimmune thyroiditis, measles, influenza, melanoma, tuberculosis, thyroiditis, hepatitis c, hepatitis, leukemia, and papillomatosis. This protein has shown to have interactions with IFNAR1, IFNAR2, IFNGR1, and IFNGR2 in pathways such as cytokine-cytokine receptor interaction, regulation of autophagy, toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, cytosolic DNA-sensing pathway, JAK-STAT pathway, all-trans-retinoic acid mediated apoptosis, and hemostasis pathway.

Long Name

Interferon alpha 16

Alternate Names

BC114392, Gm13280, IFN-alpha 16, IFN-alpha WA, IFN-alpha-WA, Ifna6T, IFNalpha WA, Ifnat6, Interferon Alpha-WA

Gene Symbol

IFNA16

Additional IFNA16 Products

Product Documents for IFN-alpha WA/IFNA16 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IFN-alpha WA/IFNA16 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...