Human Ubiquitin/Ubiquitin+1 Alexa Fluor® 488-conjugated Antibody
R&D Systems, part of Bio-Techne | Catalog # FAB701G
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Product Specifications
Immunogen
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
Specificity
Clonality
Host
Isotype
Applications
Immunohistochemistry
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Shipping
Stability & Storage
Background: Ubiquitin
Ubiquitin+1 has a carboxyl terminal amino acid sequence that differs from normal Ubiquitin. The different carboxyl terminal sequence appears to result from a frameshift in the Ubiquitin mRNA. The underlying mechanisms creating the mRNA frameshift are not clearly understood. The occurrence of the frameshift that generates Ubiquitin+1 is much more prevalent in patients with Alzheimers Disease or with Down Syndrome than in control individuals who are not afflicted with the disorders. The monoclonal anti-Ubiquitin+1 (Catalog # MAB703) and rabbit polyclonal anti-Ubiquitin+1 (Catalog # AF703) antibodies were raised against the Ubiquitin+1 carboxyl terminal sequence that differs from normal Ubiquitin and are therefore non-reactive with Ubiquitin. Monoclonal anti-Ubiquitin (Catalog # MAB701) detects both Ubiquitin and Ubiquitin+1 indicating that the epitope recognized by this antibody is contained in the portion of the proteins that are identical.
Additional Ubiquitin Products
Product Specific Notices
This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.
For research use only