Skip to main content

HLA DPB1 Antibody [Alexa Fluor® 350]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35186AF350

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Alexa Fluor 350 (Excitation = 346 nm, Emission = 442 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 30-225 of human HLA DPB1 (NP_002112.3).

Sequence:
RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for HLA DPB1 Antibody [Alexa Fluor® 350]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: HLA DPB1

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.

Alternate Names

DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1

Gene Symbol

HLA-DPB1

Additional HLA DPB1 Products

Product Documents for HLA DPB1 Antibody [Alexa Fluor® 350]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HLA DPB1 Antibody [Alexa Fluor® 350]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...