Haptoglobin Antibody (7C1N2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16700

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16700-100ul
NBP3-16700-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7C1N2 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Haptoglobin Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (P00738). DQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Haptoglobin Antibody (7C1N2) (NBP3-16700) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Haptoglobin Antibody (7C1N2)

Western Blot: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Western Blot: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Western Blot: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Western blot analysis of extracts of various cell lines, using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 10s.
Immunohistochemistry: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunofluorescence analysis of rat liver using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry-Paraffin: Haptoglobin Antibody (7C1N2) [NBP3-16700]

Immunohistochemistry-Paraffin: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunohistochemistry of paraffin-embedded human liver cancer using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 2 more images

Applications for Haptoglobin Antibody (7C1N2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Haptoglobin

Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.

Alternate Names

HP, HP-1, hp2-alpha, HPA1S

Gene Symbol

HP

Additional Haptoglobin Products

Product Documents for Haptoglobin Antibody (7C1N2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Haptoglobin Antibody (7C1N2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.