Glutamate Receptor 6 Antibody (4B4L9)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16867
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4B4L9 expressed in HEK293
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Glutamate Receptor 6 (Q13002). MGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Glutamate Receptor 6 Antibody (4B4L9) (NBP3-16867) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Glutamate Receptor 6 Antibody (4B4L9)
Western Blot: Glutamate Receptor 6 Antibody (4B4L9) [NBP3-16867]
Western Blot: Glutamate Receptor 6 Antibody (4B4L9) [NBP3-16867] - Western blot analysis of extracts of Mouse brain, using Glutamate Receptor 6 Rabbit mAb (NBP3-16867) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Western Blot: Glutamate Receptor 6 Antibody (4B4L9) [NBP3-16867]
Western Blot: Glutamate Receptor 6 Antibody (4B4L9) [NBP3-16867] - Western blot analysis of extracts of 293T cells, using Glutamate Receptor 6 Rabbit mAb (NBP3-16867) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Immunohistochemistry: Glutamate Receptor 6 Antibody (4B4L9) [NBP3-16867] -
Immunohistochemistry: Glutamate Receptor 6 Antibody (4B4L9) [NBP3-16867] - Immunohistochemistry analysis of Glutamate Receptor 6 in paraffin-embedded human colon carcinoma tissue using Glutamate Receptor 6 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Applications for Glutamate Receptor 6 Antibody (4B4L9)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: GluR6/GRIK2
Long Name
Glutamate Receptor 6
Alternate Names
EAA4, GLR6, GluK2, GLUK6, MRT6
Gene Symbol
GRIK2
Additional GluR6/GRIK2 Products
Product Documents for Glutamate Receptor 6 Antibody (4B4L9)
Product Specific Notices for Glutamate Receptor 6 Antibody (4B4L9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...