Skip to main content

GCNT2 Antibody - BSA Free, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP3-04839

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-04839-20ul
NBP3-04839-100ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for GCNT2 Antibody - BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 203-402 of human GCNT2 (NP_663630.2). IVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for GCNT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glucosaminyl (N-acetyl) Transferase 2/GCNT2

GCNT2 encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Long Name

Glucosaminyl (N-Acetyl) Transferase 2, I-Branching Enzyme (I Blood Group)

Alternate Names

CCAT, CTRCT13, GCNT2C, NACGT1, NAGCT1, ULG3

Gene Symbol

GCNT2

Additional Glucosaminyl (N-acetyl) Transferase 2/GCNT2 Products

Product Documents for GCNT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GCNT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...