Skip to main content

GCNT2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-88781

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-88781
NBP1-88781-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for GCNT2 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GCNT2 Antibody

Immunocytochemistry/Immunofluorescence: GCNT2 Antibody [NBP1-88781] - Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GCNT2 Antibody [NBP1-88781] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: GCNT2 Antibody [NBP1-88781] - Staining of human Duodenum shows strong positivity in Golgi apparatus in glandular cells.

Applications for GCNT2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glucosaminyl (N-acetyl) Transferase 2/GCNT2

GCNT2 encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Long Name

Glucosaminyl (N-Acetyl) Transferase 2, I-Branching Enzyme (I Blood Group)

Alternate Names

CCAT, CTRCT13, GCNT2C, NACGT1, NAGCT1, ULG3

Gene Symbol

GCNT2

Additional Glucosaminyl (N-acetyl) Transferase 2/GCNT2 Products

Product Documents for GCNT2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GCNT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...